CDH3
Human, Recombinant, 0.05 mg
Catalog #5124-0.05MG (formerly #5124)
![]() |
Directions for UseSDSCertificate of OriginCertificate of Analysis
|
Full Product Description
Human CDH3 gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. This gene is located in a six-cadherin cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. In addition, aberrant expression of this protein is observed in cervical adenocarcinomas. Mutations in this gene have been associated with congenital hypotrichosis with juvenile macular dystrophy.
Full-length extracellular domain of human CDH3 gene (108 – 645 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.
Parameter, Testing, and Method |
CDH3, Human, Recombinant |
Quantity |
0.05 mg (50 µg/vial) |
Volume |
0.1 mL |
Concentration |
0.5 mg/mL |
Purity |
>90% |
Formulation |
Formulated in 20 mM pH 8.0 Tris-HCl Buffer, |
Form |
Solution |
Production Type |
Recombinant – E. coli |
Storage Temperature |
-20 °C |
Shelf Life |
12 months after receipt |
Sterilization Method |
Filtration |
Cell Attachment Activity |
Passes |
Sterility |
No growth |
Gene Symbols |
CDH3 (CDHP; HJMD; PCAD) |
Accession Number |
NP_001784 |
Recombinant Protein Sequence |
MASMTGGQQMGRGHHHHHHGNLYFQGGEFDWVVAPISVPENGKGPFPQRLNQL KSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHA VSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDE DDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQ ATDMDGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRLTVTD LDAPNSPAWRATYLIMGGDDGDHFTITTHPESNQGILTTRKGLDFEAKNQHTLYVE VTNEAPFVLKLPTSTATIVVHVEDVNEAPVFVPPSKVVEVQEGIPTGEPVCVYTAED PDKENQKISYRILRDPAGWLAMDPDSGQVTAVGTLDREDEQFVRNNIYEVMVLAM DNGSPPTTGTGTLLLTLIDVNDHGPVPEPRQITICNQSPVRQVLNITDKDLSPHTSP FQAQLTDDSDIYWTAEVNEEGDTVVLSLKKFLKQDTYDVHLSLSDHGNKEQLTVIR ATVCDCHGHVETCPGPWKGG |
Preparation and Usage
- Thaw CDH3 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly. Note: Use 1 ml PBS per well in a 6-well plate.
- Add 1 – 10 µg protein to each well and incubate at 2 to 10°C overnight.
- After incubation, aspirate remaining material.
- Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.
Coating this recombinant protein at 1-10 ug / well (6 well plate) in T cell specific medium can be used 1) for human tumor cell metastatic regulation study in vitro or 2) as a highly purified recombinant antigen as cancer biomarker for diagnosis application development.
References:
Cheung,L.W., eal. P-cadherin cooperates with insulin-like growth factor-1 receptor to promote metastatic signaling of gonadotropin-releasing hormone in ovarian cancer via p120 catenin. Oncogene 30 (26), 2964-2974 (2011)
Turashvili,G., et al. P-cadherin expression as a prognostic biomarker in a 3992 case tissue microarray series of breast cancer. Mod. Pathol. 24 (1), 64-81 (2011)