CD274
Human, Recombinant, 0.1 mg
Catalog #5126-0.1MG (formerly #5126)
![]() |
Directions for UseSDSCertificate of OriginCertificate of Analysis
|
Full Product Description
Human CD274 (programmed cell death 1 ligand 1) is a cell membrane protein which is involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production. Recent data indicated that cancer cells that express PDL1 promote tumor progression through inhibition of PD1-expressing immune effectors. In addition, PDL1 modulates cell-mediated immunity in the infectious disease setting.
Recombinant human CD274 extracellular domain cDNA (19-238 aa, derived from BC074984) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.
Parameter, Testing, and Method |
CD274, Human, Recombinant |
Quantity |
0.1 mg (100 µg/vial) |
Volume |
0.2 mL |
Concentration |
0.5 mg/mL |
Purity |
>90% as measured by SDS PAGE |
Formulation |
Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-arginine, DTT and Glycerol |
Form |
Solution |
Production Type |
Recombinant – E. coli |
Storage Temperature |
Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days |
Shelf Life |
12 months after receipt |
Sterilization Method |
Filtration |
Cell Attachment Activity |
Passes |
Sterility |
No growth |
Accession Number |
NP_054862.1 |
Recombinant Protein Sequence |
MASMTGGQQMGRGHHHHHHGNLYFQG^GEFFTVTVPKDLYV VEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEE DLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRC MISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQA EGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRIN TTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER |
Preparation and Usage
Use these recommendations as guidelines to determine the optimal coating conditions for your culture system.
- Thaw CD274 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly.
- Add appropriate amount of diluted material to culture surface.
- Incubate at room temperature for approximately 1 – 2 hours.
- Aspirate remaining material.
- Rinse plates carefully with dH2O– avoid scratching bottom surface of plates.
- Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.
Coating this recombinant protein at 5-10 ug / well (6 well plate) in a specific culture medium may be used for 1) human T and B cell cells activation/differentiation study or 2) as a potential biomarker protein for infectious diseases in vitro or 3) for auto-immuno disease diagnostic development.
References:
Shoba Amarnath et al., The PDL1-PD1 Axis Converts Human Th1 Cells into Regulatory T Cells. Sci Transl Med 3, 111ra120 (2011)
Yang,J., et al., The novel costimulatory programmed death ligand 1/B7.1 pathway is functional in inhibiting alloimmune responses in vivo. J. Immunol. 187 (3), 1113-1119 (2011)
Cao,Y., et al,. Immunoregulatory molecule B7-H1 (CD274) contributes to skin carcinogenesis. Cancer Res. 71 (14), 4737-4741 (2011)
Trabattoni,D., et al., B7-H1 is up-regulated in HIV infection and is a novel surrogate marker of disease progression. Blood 101 (7), 2514-2520 (2003)
Disclaimer
This product is for R&D use only and is not intended for human or other uses. Please consult the Material Safety Data Sheet for information regarding hazards and safe handling practices.