CD14
Human, Recombinant, 0.1 mg
Catalog #5089-0.1MG (formerly 5089)
![]() |
Directions for UseSDSCertificate of OriginCertificate of Analysis
|
Full Product Description
Human CD14 (monocyte differentiation antigen CD14) is a 375 amino acid, phospholipid anchored cell surface protein. This protein is preferentially expressed on monocytes / macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide.
Full-length extracellular domain of human CD14 gene (20-345 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.
Parameter, Testing, and Method |
CD14, Human, Recombinant Catalog # 5089-0.1MG |
Quantity |
0.1 mg (100 µg/vial) |
Volume |
0.2 mL |
Concentration |
0.5 mg/mL |
Purity |
>90% as measured by SDS PAGE |
Formulation |
Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-arginine, DTT and Glycerol |
Form |
Solution |
Production Type |
Recombinant – E. coli |
Storage Temperature |
Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days |
Shelf Life |
12 months after receipt |
Sterilization Method |
Filtration |
Cell Attachment Activity |
Passes |
Sterility |
No growth |
Accession Number |
NP_000582 |
Recombinant Protein Sequence |
MASMTGGQQMGRGHHHHHHGNLYFQGTTPEPCELDDEDFRC VCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADA DPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKEL TLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQ WLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERG LMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDL SHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN |
Preparation and Usage
- Thaw CD14 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly.
- Add appropriate amount of diluted material to culture surface.
- Incubate at room temperature for approximately 1 – 2 hours.
- Aspirate remaining material.
- Rinse plates carefully with dH2O– avoid scratching bottom surface of plates.
- Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.
Coating this recombinant protein at 1-10 ug / well (6 well plate) in T cell specific medium can be used for 1) human T cell / receptor interaction study in vitro or 2) as a breast cancer biomarker for diagnosis application when combined with CD16 antigen.
References:
Schumann, R.R., et al. Structure and function of lipopolysaccharide binding protein, Science 249 (4975), 1429-1431 (1990)
Feng, A.L., et al. CD16+ monocytes in breast cancer patients: Expanded by monocyte chemo attractant protein-1 and may be useful for early diagnosis. Clin. Exp. Immunol. 164 (1), 57-65 (2011)