CDH13
Human, Recombinant, 0.1 mg
Catalog #5125
![]() |
Directions for UseMSDSCertificate of Analysis
|
Full Product Description
CDH13 gene encodes a member of the cadherin superfamily. The encoded protein is localized to the surface of the cell membrane and is anchored by a GPI moiety, rather than by a transmembrane domain. The protein lacks the cytoplasmic domain characteristic of other cadherins, and so is not thought to be a cell-cell adhesion glycoprotein. This protein acts as a negative regulator of axon growth during neural differentiation. It also protects vascular endothelial cells from apoptosis due to oxidative stress, and is associated with resistance to atherosclerosis. The gene is hypermethylated in many types of cancer.
Full-length extracellular domain of human CDH13 gene (139-693 aa) was constructed with 31 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.
|
Parameter, Testing, and Method |
CDH13, Human, Recombinant Catalog # 5125 |
|
Quantity |
0.1 mg (100 µg/vial) |
|
Volume |
0.2 mL |
|
Concentration |
0.5 mg/mL |
|
Purity |
>90% as measured by SDS PAGE |
|
Formulation |
Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-arginine, DTT and Glycerol. |
|
Form |
Solution |
|
Production Type |
Recombinant – E. coli |
|
Storage Temperature |
Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days |
|
Shelf Life |
12 months after receipt |
|
Sterilization Method |
Filtration |
|
Cell Attachment Activity |
Passes |
|
Sterility |
No growth |
|
Accession Number |
NP_001248 |
|
Recombinant Protein Sequence |
MASMTGGQQMGRGHHHHHHGNLYFQGGEFELSIVVSPILIPENQ RQPFPRDVGKVVDSDRPERSKFRLTGKGVDQEPKGIFRINENTG SVSVTRTLDREVIAVYQLFVETTDVNGKTLEGPVPLEVIVIDQN DNRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNALLR YNIRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKY ELIIEAQDMAGLDVGLTGTATATIMIDDKNDHSPKFTKKEFQAT VEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHT NPQTNEGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPS STATVHITVLDVNEGPVFYPDPMMVTRQEDLSVGSVLLTVNATD PDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLDRESPFVD NSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAE VCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKIS KINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQV CSCRNSKVDCNAAG |
Preparation and Usage
- Thaw CDH13 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly.
- Add appropriate amount of diluted material to culture surface.
- Incubate at room temperature for approximately 1 – 2 hours.
- Aspirate remaining material.
- Rinse plates carefully with dH2O– avoid scratching bottom surface of plates.
- Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.
Coating this recombinant protein at 1-10 ug / well (6 well plate) in neuronal cell specific medium can be used for 1) human neuronal cell and vascular endothelial cell / receptor interaction study or 2) for human neuronal and vascular endothelial cell/receptor interaction in vitro.
References:
Andreeva,A.V., et al. T-cadherin modulates endothelial barrier function. J. Cell. Physiol. 223 (1), 94-102 (2010).


