CD14
Human, Recombinant, 0.1 mg
Catalog #5089
 |
Directions for UseMSDSCertificate of Analysis
|
Full Product Description
Human CD14 (monocyte differentiation antigen CD14) is a 375 amino acid, phospholipid anchored cell surface protein. This protein is preferentially expressed on monocytes / macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide.
Full-length extracellular domain of human CD14 gene (20-345 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.
|
Parameter, Testing, and Method |
CD14, Human, Recombinant Catalog # 5089 |
|
Quantity |
0.1 mg (100 µg/vial) |
|
Volume |
0.2 mL |
|
Concentration |
0.5 mg/mL |
|
Purity |
>90% as measured by SDS PAGE |
|
Formulation |
Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-arginine, DTT and Glycerol |
|
Form |
Solution |
|
Production Type |
Recombinant – E. coli |
|
Storage Temperature |
Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days |
|
Shelf Life |
12 months after receipt |
|
Sterilization Method |
Filtration |
|
Cell Attachment Activity |
Passes |
|
Sterility |
No growth |
|
Accession Number |
NP_000582 |
|
Recombinant Protein Sequence |
MASMTGGQQMGRGHHHHHHGNLYFQGTTPEPCELDDEDFRC VCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADA DPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKEL TLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQ WLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERG LMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDL SHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN |
Preparation and Usage
- Thaw CD14 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly.
- Add appropriate amount of diluted material to culture surface.
- Incubate at room temperature for approximately 1 – 2 hours.
- Aspirate remaining material.
- Rinse plates carefully with dH2O– avoid scratching bottom surface of plates.
- Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.
Coating this recombinant protein at 1-10 ug / well (6 well plate) in T cell specific medium can be used for 1) human T cell / receptor interaction study in vitro or 2) as a breast cancer biomarker for diagnosis application when combined with CD16 antigen.
References:
Schumann, R.R., et al. Structure and function of lipopolysaccharide binding protein, Science 249 (4975), 1429-1431 (1990)
Feng, A.L., et al. CD16+ monocytes in breast cancer patients: Expanded by monocyte chemo attractant protein-1 and may be useful for early diagnosis. Clin. Exp. Immunol. 164 (1), 57-65 (2011)
